DPCstruct | MC440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Standard deviation of domain lengths | 2.87 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5P001 | 3-54 | GKRPVVRLCPVCHSRNIERASALSGWLTPDEYICLDCGYRGPVVLEVELVED |
| A0A256Z875 | 21-76 | TWRHPSSKVVQVCPRCGSANIKLSSKLDVWLTPKQYVCKDCGYVGPIVLELEKTED |
| A0A7J3F2D6 | 17-68 | None |
| A0A497MSY1 | 14-66 | None |
| A0A662HDV4 | 84-136 | None |
| A0A7C3U8V7 | 10-61 | None |
| A0A7C3XJV6 | 13-64 | None |
| A0A662FV36 | 94-148 | None |
| A0A1Q9N7T4 | 4-62 | None |
| A0A7J2JMY3 | 37-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.