DPCstruct | MC44
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 157 ± 17 aa |
| Standard deviation of domain lengths | 16.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8PAZ8 | 2-121 | FALLCLYLAYRVYLKIKQYQANAYRRAALAELTNLEKLEILPVLIRRVALYAYPRADVASLIGSDWEKWLDQRCAGSHFSTQFTGLL… |
| A0A353B4A7 | 8-151 | LDKMRDIAVGQPISWWPPAPAWFLVLSIAALLAGIWMIQVFVRYRQNRFRRIAMSELSAMKVGDVRRLSELLKRVALVSYPNEEVAS… |
| A0A1Y5HCK0 | 5-166 | None |
| A0A254TJ76 | 4-150 | None |
| A0A831W3S4 | 6-162 | None |
| A0A522RYK0 | 19-180 | None |
| A0A1I3E526 | 89-238 | None |
| A0A2G2D227 | 5-163 | None |
| A0A432VZF1 | 13-157 | None |
| A0A3Q9FSR0 | 20-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.