DPCstruct | MC43984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 555 ± 85 aa |
| Standard deviation of domain lengths | 85.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6KJR4 | 9-501 | DDTINAEKKKGAKMQQLKNDLDEKFYALELTIARANETLTQAIKNVQTALLSAREASLNEVDKLRKNLLETTEQAFKKVTIEVKILF… |
| A0A2H6KKL5 | 8-525 | HLTAAVKGIAMSIVNNISRLSTELKSFIEKSKIKTNLQTAIDNVKDIGNQFTDGDNGDDSNTDHGAKIDAALQKVSAAITQLEGLLG… |
| A0A2H6KK44 | 210-604 | None |
| A0A061D485 | 468-1044 | None |
| A0A061BTJ2 | 5-610 | None |
| A0A061BSQ1 | 456-966 | None |
| A0A061BQR9 | 212-904 | None |
| A0A061BQ68 | 273-816 | None |
| A0A061BKT6 | 65-504 | None |
| A0A061BJ47 | 111-635 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.