DPCstruct | MC43981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 232 ± 41 aa |
| Standard deviation of domain lengths | 41.29 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12785 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6KK69 | 1-223 | MDYSRDGGALKTLLELLETFFRLHHLNPPPNPRAPCSVYETLMWFSGLPYNSVYIDLTADGFSSLFDKTEKPASTDTHDSFISYEDL… |
| A0A2H6KJ52 | 137-335 | LAELLGHLTTYNNVCHLTIQPKPRMPCSVFEMLVWLNGLTYNRVYERLMDHIKTCFPKPKGKETAEYSDLYPHQLSLDAYPFSVTAE… |
| A0A2H6KK55 | 203-488 | None |
| A0A2H6KKC6 | 637-849 | None |
| A0A1X1BPQ0 | 134-489 | None |
| A0A2H6KKA9 | 656-837 | None |
| A0A2H6KKD6 | 116-345 | None |
| A0A061D485 | 986-1196 | None |
| A0A061BSW9 | 260-498 | None |
| A0A061BTJ2 | 457-701 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.