DPCstruct | MC43979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 330 ± 27 aa |
| Standard deviation of domain lengths | 27.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12785 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6KKL5 | 338-621 | LTTELSHAYVNAYSGKHFVGDLVTKSTEQPTEQVLSTEGRNCAKVCLTILETVNSGLKGLRKGCIKSGSGMQINLSNGLGKAFQRLG… |
| A0A2H6KJZ8 | 1-300 | MTDFDTQLDYAYVSRYSCQTIRWTRVSKPNEFTDDAKKCAKVLMSIIQTFHRDLYGLFYDIDDNDAAADQINAHAAFLGDALQDYGY… |
| A0A2H6KKA9 | 525-849 | None |
| A0A1X1BPQ0 | 12-340 | None |
| A0A1X1BIV2 | 116-428 | None |
| A0A061D485 | 871-1199 | None |
| A0A061BTJ2 | 330-674 | None |
| A0A061BSW9 | 147-470 | None |
| A0A061BQR9 | 641-977 | None |
| A0A2H6KKD6 | 1-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.