DPCstruct | MC43973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 288 ± 48 aa |
| Standard deviation of domain lengths | 47.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 32.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6KFZ8 | 2-263 | LYWMVGLNESGYIGTIEKHVHSILKDTNKDLSHPHDALEVTRDPYTLDASHVSNTLTQACLYAATVLHRLKHKDISKAVLVPDFSSE… |
| A0A2H6KAI6 | 720-999 | LVWLTGLPHNPVYKKLPKHVTSLFEVPDKNDPSSKHVMPIDASPSKITDALTNKAVEEICGKAYAVLTTVVGTGDAECGYACEFPSN… |
| A0A2H6KKM2 | 1-290 | None |
| A0A061DAH7 | 262-520 | None |
| A0A061D9D2 | 1-200 | None |
| A0A061D0J3 | 70-363 | None |
| A0A061BTJ2 | 481-800 | None |
| A0A061BSW9 | 278-571 | None |
| A0A061BIT0 | 13-266 | None |
| A0A2H6KKE0 | 224-564 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.