DPCstruct | MC4397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 189 ± 16 aa |
| Standard deviation of domain lengths | 15.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5KF86 | 1-173 | MATPYNEMIIEADRISLRANIIAWLCSWWIMAGFLIVPNAFISLKKSSILQIEPGLARHLQVSLPIIAALCFTSGTSGLSVLWRRYR… |
| A0A409YY03 | 718-898 | PHLFGGASQMDTQYVKMLLALDDIPYWYNLAASFFTWILLAGFILFPGTFTNLQAAAASNNLPVNSPFVTDAVNSITKLPLFIVAWV… |
| A0A0A2LEM8 | 1-204 | None |
| G3JR93 | 25-209 | None |
| A0A178CJ65 | 176-378 | None |
| A0A179US60 | 10-186 | None |
| A6R0J0 | 6-192 | None |
| A0A4Y7PT68 | 54-275 | None |
| K2RQ18 | 9-174 | None |
| B6GWJ6 | 527-721 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.