DPCstruct | MC43969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 227 ± 26 aa |
| Standard deviation of domain lengths | 25.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 35.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6KDJ0 | 1-248 | MAYTSLTDVPRNLKEGIDWLIALKGADAEKNLKAMGSAVYDLLADKPVGFTEVPALENVKRISKEFLEKPELKNQRSAKKLLKRYRA… |
| A7AMN8 | 1-227 | MALHQSLLEPPANLRQALDWITSIKKSNGTFPLAAAVFKFLIHGGKGTTKCKTGNNLELPLDEEDQEKLVVSTPGCWDSFLACIRVK… |
| A0A061D9Z6 | 1-247 | None |
| A0A061D148 | 3-190 | None |
| A0A2H6KFM2 | 1-220 | None |
| A0A2H6KF61 | 1-247 | None |
| A0A2H6KBK3 | 3-180 | None |
| A0A2H6K7K5 | 1-242 | None |
| A0A2H6KC17 | 1-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.