DPCstruct | MC43966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 171 ± 40 aa |
| Standard deviation of domain lengths | 40.28 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03637 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9YZF1 | 602-745 | VGYSLSGNLHIQNRFYHTAHSLCRQYYWYDERGKKIKCTAPQYVDFVMSSVQKLVTDEDVFPTKYGKEFPNSFESLVKKICKYLFHV… |
| A0A1J4JHK9 | 11-171 | EDLNEWLAVNVADFYNQLSMLYATITEFCTPQTCKSMTAGPSYKYLWQEGPKYPKPVELPACEYIGNLMDWVDAQLENEQIFPSMIG… |
| T1EEW3 | 14-183 | None |
| A0A4T0H6M3 | 76-284 | None |
| A0A6G1ECB5 | 23-122 | None |
| A0A1E5RDW5 | 460-648 | None |
| A0A7R9UCP0 | 85-280 | None |
| A0A811MBN6 | 384-563 | None |
| A0A6G1HZY1 | 22-247 | None |
| A0A6A4K7E2 | 21-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.