DPCstruct | MC43963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 162 ± 18 aa |
| Standard deviation of domain lengths | 17.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.87 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF00118- PF15065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9YVF5 | 3-169 | AAAAAAAPWAGLALLWAAGFCAGDAKGYRRRVSLEYNPGWASSRVNLLHTRAVGLNDTLHYVWSTIGVPTVLLVYTASDSSSLRVNW… |
| A0A673GBN2 | 2-155 | VSRCLREYLNPGLTPPLVLPQGVGLVHVRGLGQSDTLHFLLCNHGAPALLMVNTYSTQSAVQVDWPAFINRSSSGSLRVEPQTSVRY… |
| A0A2R7WFT5 | 122-278 | None |
| A0A2K6KMZ0 | 31-190 | None |
| A0A4Y2LQR4 | 16-169 | None |
| A0A6V7HEH1 | 101-294 | None |
| A0A654GJE7 | 18-164 | None |
| A0A0X3NR34 | 1-200 | None |
| A0A095A6T7 | 142-326 | None |
| A0A2A4JVD7 | 582-727 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.