DPCstruct | MC43961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9YQL5 | 3-92 | KKFDKKDEESGSGSNPFQHLEKSAILQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTRLFQSNDQTLRRMCY… |
| A0A453IK67 | 52-161 | QPYMKKDDDDSDIEYSPFFGIEKGAVLQEARAFHDPQLDARRCSQVITKLLYLINQGESFTKVEATEVFFAVTKLFQSNDAGLRRLV… |
| G3R0T3 | 1-90 | None |
| A0A674D5P8 | 1-92 | None |
| A0A061FVA9 | 1-94 | None |
| A0A4U0W1G9 | 2-96 | None |
| X6MMJ8 | 1-114 | None |
| A0A0G4N033 | 45-152 | None |
| A0A7J7Y7Y0 | 1-92 | None |
| A0A821V7P4 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.