DPCstruct | MC4396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 166 ± 24 aa |
| Standard deviation of domain lengths | 24.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 67.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08550 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1VDD5 | 1-149 | MSRKRTPIDNVDYLSYCWGNELDLATSWRVMTKNKDTMINGHRLENASWRKWFQQRYSLPLLNPAELNWFKDSDICWLYGPMHLHDD… |
| A0A5N5J6Q0 | 113-253 | YFPTPLERAVDDISLNPLPLRHVDYLSHNWEEEQIWESWKLIVSTRGEYSNAPRLENASWRAWMKSKSRLKTVSPETINWLKDCDVT… |
| N1J822 | 96-286 | None |
| A0A0D0VDG3 | 9-177 | None |
| I1BY53 | 1-167 | None |
| A0A1Y1Y5J2 | 2-157 | None |
| A0A2P4Z7F6 | 1-138 | None |
| A0A166DW40 | 3-225 | None |
| S8A7W9 | 161-324 | None |
| A0A5M9MA72 | 24-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.