DPCstruct | MC43959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 284 ± 33 aa |
| Standard deviation of domain lengths | 33.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9YPG8 | 2-301 | AAQNWFTLFGWSKGPNPISIPYSLRRDICKIQMTSSEEKLKLNLGKDTKTIYDMLIHLSGQLLPGISSSQVLPFDPIQRVVQLHWQH… |
| A0A194QLX4 | 236-513 | LYNYMEKSSQFLERWMFYQGFRKELYPKIPETLNALSIAMTSQAKEKSKGINVSYLNFIKRIAGPLLKHIHKVEVFDADETVRQVKD… |
| T1HLH2 | 596-906 | None |
| G1PW52 | 107-413 | None |
| S4R5N1 | 2-303 | None |
| A0A674DQB2 | 16-254 | None |
| A0A3Q2PVK3 | 18-279 | None |
| A0A5K3FK25 | 679-1008 | None |
| A0A833VNL9 | 143-437 | None |
| A0A820DUW1 | 34-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.