DPCstruct | MC43956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 161 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9YEV0 | 1-172 | MYFQPKLCQGPYLILENFQQRNIQLIQSIREFLQEDESQFNKFKMYSGQFRQGLISAEQYYKSCQELLGENFNKIFNELLVLLPDTA… |
| A0A0R3SY76 | 255-402 | STYTPPSNFEEKNMTVIEKAKEILGGPGHSKNAFTQCIRLCGLYSEGSLSAQAYIQGLSSVISSSSDPDESEWFSRMIALLPNVGLQ… |
| A9V4D7 | 395-560 | None |
| A0A183KQC0 | 156-324 | None |
| K1Q2C0 | 562-728 | None |
| A0A3S1A4I7 | 821-964 | None |
| A0A1S3QFK9 | 1-150 | None |
| A0A4Z2FR89 | 325-497 | None |
| A0A835TSB4 | 455-619 | None |
| M3YVQ2 | 670-840 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.