DPCstruct | MC43952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 4.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L8F249 | 1-81 | KMICTAGLQWYPLPEELHCIKSCEPFMGDNYCDGNNNRAFCNYDGGDCCVSTVKTKKVTPFPANCDLQGECACLDPKAEEN |
| A0A6I9Y4Q8 | 1-92 | MDHRLKPTKVQSIVCTGRLEWYPNPKSIHCIISCEPFHADGWCDTINNRAYCQYDGGDCCSSTVSSKKVVLFPNGCDEDECTCRDPA… |
| A0A044SXK3 | 758-843 | None |
| A0A401SDI0 | 637-728 | None |
| A0A183U3Y0 | 44-129 | None |
| A0A5S6PYR7 | 47-132 | None |
| A0A7J8BGG3 | 890-968 | None |
| A0A0N4TQL3 | 541-624 | None |
| A0A1I9G222 | 285-370 | None |
| A0A6J1VXN0 | 52-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.