DPCstruct | MC43951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 84 ± 22 aa |
| Standard deviation of domain lengths | 21.85 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 67.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.20 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | PF17181- PF13259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6LH87 | 218-290 | NLQQQRKHMVLGSKPPGCVNKCFSCKPCMATLVVPSHQKDPTFKALSHGDDDDSGRYYLLSWKCRCGEKLFQP |
| A0A5D2Z4R8 | 74-123 | RMMGRLGSRPPNCERKCGGCRPCVATQIPATTDKLGIQYTNYEPEGWKCK |
| A0A0D2RG96 | 25-119 | None |
| D8RVS9 | 76-174 | None |
| A0A426YFG4 | 3-60 | None |
| A0A6J1GIN2 | 3-156 | None |
| A0A4P1RR20 | 10-93 | None |
| A0A811NV78 | 82-140 | None |
| A0A4Y7J7T1 | 35-108 | None |
| A0A7N2KNX1 | 41-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.