DPCstruct | MC4395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 86 ± 14 aa |
| Standard deviation of domain lengths | 14.38 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 40.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6JXN2 | 1-97 | MDSPLPCHICDRMRTRNPRKHGGLVTEGEVQTCLLCNRDFCATHKGKFDGICEINHASYFWNHQELRGIYPSLEARQKALEEMQKVL… |
| A0A5N5IX42 | 19-94 | EGVGRACSIAQRPDKHGALEITSSTQECLLCTRDFCEKHKGTDENVCEINHTTYYQRHRQLPNVYPTLKARAETLK |
| C4JHA2 | 1-64 | None |
| A0A6A6UEL3 | 26-144 | None |
| A0A1Y2G774 | 11-94 | None |
| A0A2T4CBJ6 | 8-95 | None |
| A0A4Y8DAZ6 | 3-88 | None |
| A0A1L9VF50 | 5-91 | None |
| J3PFN7 | 49-158 | None |
| A0A5N6XN00 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.