DPCstruct | MC43942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 145 ± 16 aa |
| Standard deviation of domain lengths | 16.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840NTG9 | 1-143 | MDHSTRESKANIAKDRTGRFDLSNNTVCTLKISTNEKGDDGKLLDIAQRARSDISVLNLNNSSIVFNGPIDDHSHTLHIGSGKPDTP… |
| A0A336NIZ7 | 1-121 | MQNNTKWTLKTSTNKKSQNEQLLDIAQRVRSDISVLNINDSSIVFEEPTEDHYHTLHIGSGRPNTKKVYNATGKAEIHFNVEWSDSA… |
| A0A3S5C0U0 | 15-153 | None |
| A0A5B9CYI9 | 443-599 | None |
| J1IXJ6 | 59-173 | None |
| A0A840NXG2 | 1-148 | None |
| A0A2D1LTF2 | 20-180 | None |
| E6YUT5 | 18-180 | None |
| A1UTU0 | 471-625 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.