DPCstruct | MC43941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 6.68 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380KMG3 | 1-85 | MLHLADGGDKSAFQWWLDEITKQSVDFDIVGISYYPYWYGTLAELSENMDNISERYNKKVVVVETAYANTLDNLDQKTNAVTATE |
| A0A485B3C7 | 1-85 | MLHLAEGTKNDTFRWWFDEISKRNVPYDIIGLSMYTYWNGPISALKANMDDISRRYNKDVIVVEAAYAYTLENCDNAENSFQAKE |
| E6LHW7 | 74-155 | None |
| F2JNT0 | 552-631 | None |
| A0A2X1B5A4 | 1-84 | None |
| A0A3R5WJ32 | 401-480 | None |
| A0A5S9MKS3 | 107-191 | None |
| A0A315XWK6 | 230-309 | None |
| E4Q4A2 | 112-194 | None |
| A0A402DQI6 | 240-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.