DPCstruct | MC4394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.92 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 58.07 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0010- PF02365- PF00203 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287ICW4 | 108-165 | PVVRGVVMNPVDHPHGGGEGKAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRRK |
| A0A7X7P4U4 | 1-57 | PTVRGVAMNPVDHPMGGGEGRSSGGGHPVTPWGQLTKGKRTRSKRKPSGKFIVKRRK |
| A0A5N6PF17 | 632-690 | None |
| A0A5D2AP10 | 126-184 | None |
| A0A7C3Q7Q3 | 63-121 | None |
| A0A816J3F7 | 84-142 | None |
| A0A1A9VJY6 | 595-653 | None |
| F6GT24 | 110-168 | None |
| K2DBJ0 | 1-78 | None |
| A0A7J7L6R7 | 217-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.