DPCstruct | MC43938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 226 ± 35 aa |
| Standard deviation of domain lengths | 34.65 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518HU69 | 2-190 | NISGEDYEIGEAVVWDDVLSVTDADDFNPREALVDFVCEADRPTWHDSVASLGIVLDDTPDDDFGRVVIGGAAVVRLSDATDGAYAF… |
| A0A142Y543 | 31-219 | QFRSSEAKTYFRNDTGQVIPAYGIIQASGTAKVSNVNYVTVERPFDYAAAQSIYLVNGPQEVKVDGYGTTQPGPYYKILSDGGTYSA… |
| A0A518C3C7 | 116-342 | None |
| A0A3D1UN31 | 40-237 | None |
| A0A1I3EBS9 | 10-182 | None |
| A0A2E2B1Y5 | 12-255 | None |
| A0A1V5ULW7 | 1-264 | None |
| A0A3C1GD02 | 6-294 | None |
| A0A4V0I836 | 51-273 | None |
| A0A1V5NG20 | 6-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.