DPCstruct | MC43935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 244 ± 38 aa |
| Standard deviation of domain lengths | 37.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518HKF5 | 16-242 | NFSDLQYAEINNFAEYGQPVSPYQPGYDHDHVPDFGNVVIEMTQAAVMNSGYGENITTLDFPLVNHFLDNGVMMGDTRYMPQVVERG… |
| A0A5S4EPI9 | 11-242 | REITNLYLYGQPSTPADMADASRIRAPGPGNGAAVDVNMPSFMSTGPGRFALGALSRLVQTFFRADADRDWMETNRAYSMAEIKNEL… |
| A0A4V7IEF2 | 11-310 | None |
| A0A420FYM4 | 5-197 | None |
| A0A824IZW7 | 12-237 | None |
| A0A5C0DU18 | 7-239 | None |
| A0A179CZE2 | 7-218 | None |
| A0A433UXI9 | 8-239 | None |
| H8GI81 | 5-222 | None |
| A0A2S6HGB5 | 1-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.