DPCstruct | MC43931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 136 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A563VKY3 | 1-125 | MKSISAVIRNSTGKAVGLMCINLDLSKFEEFRQIIDRFMCPDRLIPQPQELFKDDWQERINIFVHEHLRNQHKHFDNLTRTDKQELV… |
| A0A7Y2DNG7 | 7-155 | VEFLVEPFVEGRPGPHVDAAIDAFAAKGLNVEMGPFSSSSAGDIDAIAEAVGAMIRSSMKAGASAIRIQVGARREDLDAVGSLKNAL… |
| A0A261UYK9 | 213-357 | None |
| A0A2N2B555 | 1-115 | None |
| A0A1H0BS04 | 443-581 | None |
| A0A2X2DQ36 | 2-130 | None |
| A0A5E4YYH1 | 161-283 | None |
| A0A165RX84 | 188-324 | None |
| A0A7K3B4Q2 | 66-218 | None |
| A0A375D3Y6 | 44-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.