DPCstruct | MC43926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 87 ± 11 aa |
| Standard deviation of domain lengths | 11.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 65.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9G1X7 | 1-68 | MDKFLQGLFVLANDPAAEVRKLVCAAFVQLIEIHPSFLEPHLKNVIEYMLQVSKDTDDEVALEACEFW |
| A0A1U8P6L7 | 6-108 | ALYASVDKYLHGLFGLANDPAAEVRKLVCAAFVQLIEVRPSVLEPHMKNVIEYMLQVNKDTDDEVALEACEFWVQGIVLEQDNIDPM… |
| A0A7J9G6H6 | 3-78 | None |
| A0A2I0TAL2 | 23-110 | None |
| A0A5D2D0E9 | 53-141 | None |
| R1CSP5 | 156-250 | None |
| A0A819WMZ2 | 11-116 | None |
| A0A5D2LJD6 | 43-117 | None |
| A0A5D2LEG3 | 54-128 | None |
| A0A5D2L6Q1 | 6-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.