DPCstruct | MC4392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 390 |
|---|---|
| Mean domain length (aa) | 195 ± 48 aa |
| Standard deviation of domain lengths | 47.58 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.79 |
| Pfam Score | 59.52 |
| Assigned Pfam label(s) | CL0123- PF07596- PF07963 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7NBN9 | 10-204 | IELLVVIAIIAILAAMLLPALSKARDKARATSCVSNLKQLGLAFTMYSTDYEGFACPVHVKQNVETWSGTIWYLDLTHQYYGDAKIS… |
| A0A1V6D8C8 | 282-424 | EVKLEAELNAALVQKLLAGLQSAQRQAVRVTSAAHLKSIGVAVASFQADNYDKSPPSLKALVEKHLIPANMLVSPASRRQIKTDAKG… |
| A0A7C7Z499 | 325-443 | None |
| A0A3M1SX88 | 102-281 | None |
| A0A7C3DRH3 | 67-323 | None |
| A0A517YST8 | 1-224 | None |
| A0A3D5A0B0 | 3-133 | None |
| A0A3R8K556 | 94-287 | None |
| A0A3D6D4J7 | 2-181 | None |
| A0A851GI05 | 4-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.