DPCstruct | MC4391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 151 |
|---|---|
| Mean domain length (aa) | 166 ± 33 aa |
| Standard deviation of domain lengths | 33.07 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 91.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7M2Q4 | 32-217 | ITSRRQIKAILDMLRREFPDRKFGLETLPSAIGIREGLHVESIGTLTGEELLAGRRFPDAIGNGTYPVDIHNDTDATISFKNLNGTM… |
| A0A7C4ILX8 | 267-428 | VWDYIKNSGKHPQARTWALDWFGWVPGKRESRRFIGQYVLRESDLLTSRHFDDAIAYGGWKIDLHPPEGVDRPDLPPFTPIDVPHLY… |
| A0A1G7ZQ18 | 2-128 | None |
| A0A7X7FC27 | 274-435 | None |
| A0A7X7FHA5 | 38-259 | None |
| A0A6I7PJP8 | 318-491 | None |
| A0A7J3NVD6 | 25-231 | None |
| A0A1H4GTU3 | 58-199 | None |
| A0A562WN65 | 3-137 | None |
| A0A356AZ32 | 53-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.