DPCstruct | MC43906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 279 ± 43 aa |
| Standard deviation of domain lengths | 42.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534ZFE5 | 3-232 | GGTVLGQYDRSLGWDDMHSMNNAGIVFDDSQLAVDGIRIDNVTDGVRPKLADDFTIRNVHLSYVRDDCVENDHVHGGLVDDSLFDGC… |
| A0A2V7MWY6 | 14-265 | NTSLADNTGIDASAAQWRTAAHISIRLGGGANVCFHGGETVGNLPPATTWSTALNYYAMVPDGPNVTVEGVRTFNRGDGVAFGSNAP… |
| A0A534ZU25 | 990-1239 | None |
| A0A0S8A2F2 | 43-360 | None |
| A0A0G1V324 | 140-389 | None |
| A0A1Q7DWW6 | 6-225 | None |
| A0A1G4AH70 | 45-405 | None |
| A0A848X6Q1 | 56-356 | None |
| A0A848X6H5 | 179-510 | None |
| A0A2W7MZZ1 | 34-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.