DPCstruct | MC43901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 116 ± 20 aa |
| Standard deviation of domain lengths | 20.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845F170 | 8-108 | LQNEIIRYQEQLRHFRISLLKLPAKMPSEDKVRNLCKEAAWKIAATETLVVKIFKSKKLPYRELSKQFFFNIEILKQHSQYILALFL… |
| A0A0V8J982 | 34-133 | SISPDKEIEHYKSRLLQFGINIYEMPKLTPQSKKSRLDAYTIASYIANNTELKSLFLTKKGLPASQLSEKFPSKSIRRYTPYIIAVA… |
| A0A3D8PSD4 | 109-240 | None |
| A0A419GE59 | 139-271 | None |
| A0A6M6E8X7 | 35-152 | None |
| A0A1V5M763 | 67-187 | None |
| A0A226C1U0 | 4-100 | None |
| A0A3T1D218 | 57-184 | None |
| A0A5S3QP95 | 4-97 | None |
| A0A7X9EUH2 | 2-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.