DPCstruct | MC43900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 247 ± 27 aa |
| Standard deviation of domain lengths | 26.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381ANF8 | 4-205 | QRHVNAPKGVRDLTLLDHDVDIKNTVSRSWSWMIPPETYRDEEPVILLAADEDERKSWMGLMVAREAYLGAPNRDGKRGVLSSAYGN… |
| A0A372ZR54 | 47-278 | RFEFDLGYGKPMDYTVAGHPVDAKFTLNRFAWQIPQEAVGHICLLMNADDRAGTFSVGLVRVTSEILRAKGNQDKKRVIAAGQRSAI… |
| A0A498BPX4 | 24-267 | None |
| A0A6B2T0F4 | 816-1047 | None |
| A0A2T3BUE3 | 54-296 | None |
| A0A4Q8CVK4 | 333-604 | None |
| A0A2V6CCG2 | 16-221 | None |
| A0A4Y3RXK4 | 234-507 | None |
| A0A839RH67 | 66-350 | None |
| A0A6G2ZKN8 | 12-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.