DPCstruct | MC43897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 245 ± 41 aa |
| Standard deviation of domain lengths | 41.33 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.96 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S9J6Q6 | 1-227 | MVLHLLGKKSWNVYNKDNVDRVRQDEAAVQAREEEAERRMQEEDAARRTAILRGEAPPLISSQSPQPEEGAARRRRDDGHGQDRKRR… |
| A0A5N6IKD6 | 13-293 | FLLIASSHLLGKKSWNVYNPENIARVRRDEAQAQAREEEQERRMQEVDAERRIQILRGERPSTPPPPPRSPSPVSRHDRKSYAEDTA… |
| A0A423X477 | 1-293 | None |
| A0A1E3BME5 | 1-202 | None |
| A0A420YGG4 | 1-245 | None |
| A0A0D2ICC2 | 1-269 | None |
| A0A395IID7 | 1-172 | None |
| A0A4S9U695 | 109-385 | None |
| A0A0D2AUE3 | 1-288 | None |
| A0A2C5XDL6 | 1-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.