DPCstruct | MC43893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 80 ± 18 aa |
| Standard deviation of domain lengths | 17.75 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 25.87 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | PF00327- PF00410 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O67562 | 2-56 | SKLKVKLLRGLAGESERHIQAVKSLGLKKRGQERILEDNPLVWGNIRKAFHLVGV |
| A0A821LZ41 | 12-83 | HKLHIVTRIRSTKRRSYWEKDTIKMLGLQKAHSPQIHKNILSVNAKLKVVKHLIRIQPLKLPQGLPTEETMS |
| R7UJU9 | 1-106 | None |
| F4PZJ8 | 59-126 | None |
| A0A0C2J3T8 | 2-72 | None |
| A0A084RS45 | 659-738 | None |
| A0A3A4UFF9 | 2-76 | None |
| A0A6I8NY50 | 248-342 | None |
| T0TB38 | 3-82 | None |
| A0A2E4AEA4 | 45-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.