DPCstruct | MC43891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 376 ± 39 aa |
| Standard deviation of domain lengths | 38.59 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821LKI1 | 24-399 | LLCAENVDQENLQSYAREAADFATNYQLPSLDFAINHYGQPDVAMFDFTSMYASEDAALVRERYGHHLLVALVGDSLLEPFWPMGTG… |
| A0A0M3J2N6 | 2-311 | KERTGVDLENIVYYKDDTHYFVMCAKKQSLIEKGVICEEKLCEYAMQAADFATEYRLPELKFSKNHNQREDVAMFDFTSLFSAKCSV… |
| A0A369SDG5 | 319-704 | None |
| A0A044QUV2 | 315-769 | None |
| H3B992 | 319-699 | None |
| A0A6I9YXA1 | 34-442 | None |
| A0A0B1SPG6 | 1-411 | None |
| A0A1A8A704 | 2-361 | None |
| A0A4Z2B553 | 1-344 | None |
| A0A1Y3F060 | 211-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.