DPCstruct | MC43890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 140 ± 7 aa |
| Standard deviation of domain lengths | 7.34 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07324 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803VKG9 | 1-147 | MAWPGGFEAAEQQQQQQQQVLSRQQERHYRLLAELQALVKALPSACQQRLSYTTLSELALALLDGTVFEIVQGLLEIQHLTEKNLYS… |
| A0A821LAF7 | 1-135 | MAGYLGTYGEPSDITQQQERHYYLLSELQSLVKDLPSSFQQRLSYTTLSDLALALIDGTVFEIVQGLLEIQHLTEKNLYNQRIKLHA… |
| A0A1B0CEE5 | 1-132 | None |
| A0A672P6S0 | 1-145 | None |
| A0A3Q0D3N7 | 1-147 | None |
| Q5DHL9 | 3-144 | None |
| A0A6J0GE40 | 1-128 | None |
| A0A4Z2J818 | 1-150 | None |
| A0A6F9DBE4 | 2-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.