DPCstruct | MC4389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 112 ± 15 aa |
| Standard deviation of domain lengths | 14.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 37.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9Z2F9 | 385-478 | AFRCPVPGCKYMPPSARRKSDIRRHLETHRSNENQQRWVCCGVPVDSAEQYGIKKVGQTYWWRGWRMVGGCRRGFSRRDSLGRHLKT… |
| A0A371DUW8 | 1-122 | MPSASSSPALAPSSPSGSSSQRPCKHCNQIFPRMKGKELERHEDSHEGEEKALHWVCTGVPILRASEYGLKDKDVQKYITAGRVMLY… |
| A0A5C2T3C7 | 250-360 | None |
| A0A1Y2IJ25 | 159-255 | None |
| A0A401H064 | 301-400 | None |
| F8PZP1 | 68-170 | None |
| A0A4Y9YXF6 | 870-964 | None |
| A0A0C3A6J5 | 26-121 | None |
| A0A5K1JV85 | 204-317 | None |
| A0A5C3NVI2 | 75-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.