DPCstruct | MC43883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 234 ± 49 aa |
| Standard deviation of domain lengths | 48.62 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.36 |
| Pfam Score | 87.32 |
| Assigned Pfam label(s) | PF02919- CL0382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821F2G5 | 49-268 | EDGVKWKFLEHRGPYFAPGYEPLPDDVRFLYDGESMKLSLEAEEVATFYGKMLDHEYTTKEIFQKNFFTDWKTQMSKEEKKTIKQLY… |
| W5PFP4 | 214-467 | KWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLNHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDF… |
| A0A177AWQ5 | 256-508 | None |
| A0A7N0U261 | 2-189 | None |
| B4LSA9 | 14-272 | None |
| A0A2V0PNI9 | 38-351 | None |
| A0A017SF00 | 110-278 | None |
| R7QQ71 | 65-276 | None |
| A0A7J6Q4M3 | 34-312 | None |
| A0A0C2J5J7 | 55-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.