DPCstruct | MC43882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 368 ± 90 aa |
| Standard deviation of domain lengths | 90.34 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 72.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 30.38 |
| Pfam Score | 92.24 |
| Assigned Pfam label(s) | PF16180- PF05602- CL0141 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821DGW8 | 68-405 | GKQVHIVSPLTTYMIPKPEEVNLITGETGTQQIDTDKKESNALDEPVSHWRSRLTLNVMMEDFIFDGSSLPADVHRYMKMIQLGKSV… |
| A0A446L500 | 135-339 | EGPVEYISYWKPNVTINLVDDFTRYPQNNIPPNVAPYLNVDPTTNSYYPTVFFNEFWLLRDKLTALNETVKELTLNLEVSPISMTKW… |
| A0A7R8XIG3 | 812-1231 | None |
| A0A0D8XGK4 | 67-300 | None |
| A0A6S7GKH5 | 257-739 | None |
| A0A819Q042 | 113-587 | None |
| A0A3B5Q3J6 | 6-330 | None |
| A0A177V988 | 207-726 | None |
| A0A7J6LSY6 | 405-835 | None |
| A0A2V2XBX5 | 3-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.