DPCstruct | MC4388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 145 ± 16 aa |
| Standard deviation of domain lengths | 16.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A371DP00 | 3-156 | CTHDAYQLSDALPFPITAALPEDFSRDADDIAVWQAAVKPATRFVQNPFMFCSPFEPVTQLLFNRADKMTAAEVIGDMRGIFEGKST… |
| A0A4S9ZRY6 | 594-715 | RVSKYSLKFPTPSDDMLNRPHFTVVFWNTSLGAVPTSLRWLLLDDEEGDRSRKAIKIREEGIHILTTFQWSSDTTTASFWLQSDVVM… |
| A0A5N5Q1E0 | 355-542 | None |
| R1ETX4 | 68-218 | None |
| A0A4S9ICW1 | 255-389 | None |
| G4UZ01 | 23-159 | None |
| A0A1Y6L5J4 | 2-120 | None |
| A0A401H6N4 | 296-429 | None |
| A0A427YH41 | 118-259 | None |
| G2YGF4 | 439-580 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.