DPCstruct | MC43878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 6.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 65.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835A0P4 | 1-55 | MPWACKAFSQLHAQLLAQNPSLLGCWRIFMIKLWNHNLLDARSMNTCNMIIDNFK |
| A0A0L9TV94 | 55-117 | VIADGHISWACEAFSKLHAPEFVRSRSLAGCWRIFMVKLYNHGLLDARTMNDCNVILEQQHKQ |
| A0A2G2X4Q9 | 283-357 | None |
| A0A6P6FN64 | 236-300 | None |
| A0A2U1Q3H3 | 55-117 | None |
| A0A0R0HS33 | 326-402 | None |
| A0A7I8IGS5 | 96-158 | None |
| A5B5M8 | 164-226 | None |
| A0A446UWA8 | 494-555 | None |
| A0A287GUW8 | 265-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.