DPCstruct | MC43875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 7.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 45.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5VMG5 | 14-101 | WTEEDKAICASVLGSDAFTYLTKCGGAISEGLVAASVLADLQNKLQNLVEADGQSLRWNYAIFWQLSRTKSGAVVLGWGDGSCREPHD |
| A0A0Q3PMR4 | 1-92 | MAWSETDAALFAAVLGRDAAHHLATTPPHLDGPPASAAPELQARLQDLVERGGGVWTYGIFWQESRGARGRVVLGWGDGHCRDGGAP… |
| A0A2G2WSG6 | 3-97 | None |
| A0A1E5W2D4 | 71-172 | None |
| A0A2G3B2V5 | 3-91 | None |
| A0A446SDC0 | 1-110 | None |
| A0A314ZSM2 | 28-132 | None |
| A0A2P6PQ69 | 5-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.