DPCstruct | MC43863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 149 ± 16 aa |
| Standard deviation of domain lengths | 15.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3NC13 | 1-161 | MRTGDNSSADCGATVLPPGYGVFFNNRTAVTSILAYGEVRANNFVRPLDPGSNLVASGYPVDQSPLGVSGREMTRAQGFFGSRDFAT… |
| A0A7C4LET8 | 148-265 | VIDATNAVIPIYEGLNLISYPFSCEFDVNASTLTTNNGVIGGTFYTTADWILVWDPVGRTYHKWAVKASDGKWHYADSAATWAGGPV… |
| A0A7X8R6J0 | 1-166 | None |
| A0A3M1GE57 | 1-142 | None |
| A0A355SWM8 | 111-259 | None |
| A0A7Y2U7T0 | 11-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.