DPCstruct | MC43859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 322 ± 57 aa |
| Standard deviation of domain lengths | 57.23 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2SJM0 | 1-397 | MRGLKFFRVKGRFNEKGQFTNLLPLKNLPSGIIAFTLYGSNDTPVAERLHFRWDEKNMLSLKAKPSKEIFSKREKMNIPITVGNASS… |
| A0A7X9IA37 | 1-212 | MRLSLDDLPYGVLHLTLSGPDQTPLCEKLFYHDVEEAYLEIVPDKQVYNKRSPVTAVLSLKGNSLIFDQVFISLSAAESTYLNSDSG… |
| A0A016BQF7 | 1-307 | None |
| A0A5B8UQB1 | 235-616 | None |
| A0A7W5ZJ79 | 529-966 | None |
| A0A521GH65 | 468-798 | None |
| A0A1H4FQG7 | 46-356 | None |
| A0A7Y3FV17 | 153-446 | None |
| A0A497CZ20 | 264-579 | None |
| A0A3D3PCA1 | 636-926 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.