DPCstruct | MC43858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 239 ± 70 aa |
| Standard deviation of domain lengths | 70.15 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 87.27 |
| Assigned Pfam label(s) | CL0062- PF13722 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2H9B0 | 20-287 | PTVPLIVACGALSGFHALVGSGTSSKQLDNELHGLLVGYGGMFTEGFLSTIVIVSIAVYGFTVFSEIGASMTSALWGSKYAVTVVSK… |
| A0A0X8HC26 | 47-265 | EGMLALAAILAATAGFATFADWEAMYTAFGAGGVTAFVEGGAFMIHNGLGLPEATAATLLTVMAALFAGTTMDTGLRLQRYIFQEWG… |
| A0A645HVK7 | 2-179 | None |
| A0A7C1BE74 | 13-202 | None |
| A0A349VG59 | 81-379 | None |
| A0A7V1K634 | 13-160 | None |
| A0A7X8FTA6 | 3-292 | None |
| A0A645J3G6 | 5-173 | None |
| T0CXB4 | 1-203 | None |
| A0A7C1URW5 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.