DPCstruct | MC43854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 51 ± 2 aa |
| Standard deviation of domain lengths | 2.09 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9NHE5 | 1-49 | MAGYGYGIPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSEEPLP |
| A0A3P7IH11 | 14-68 | QAPLAGYGYGLPLSRLYARYFLGDLFLVSMEGYGTDACIYMKAVPIEASEVLPIY |
| A0A7S1JSP7 | 5-53 | None |
| A0A3L7IIB3 | 8-55 | None |
| F2SBI1 | 22-73 | None |
| A0A7S2C8M2 | 4-54 | None |
| A0A3R6Y6F0 | 16-66 | None |
| A0A7S2F9J5 | 47-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.