DPCstruct | MC43843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 216 ± 36 aa |
| Standard deviation of domain lengths | 36.21 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13700 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T3NLY6 | 115-342 | YLGTFLENPEDVPDAVVDYVAEQLGVPTTAFAGYGAMEHRWDHQDRIREAYGYTKFEFDQWFALARWMYQRAWIASERPTLIFDLAT… |
| A0A4R4WP82 | 3-189 | GYREFAEAEAELRTFISSRAAQTRDSRRELFDRAVVWLIEGRVLLPGITTLAPLVASVRAESLVAINDHLVEQTPLGMRRELLDTLV… |
| A0A1Y6D5C5 | 20-269 | None |
| A0A2N3YUI4 | 65-288 | None |
| A0A0E3B8H8 | 54-291 | None |
| A0A3S9PBY7 | 17-236 | None |
| A0A100IZM6 | 3-214 | None |
| A0A1S2NUI0 | 3-222 | None |
| A0A4R4VKV9 | 11-213 | None |
| A0A375FJ81 | 14-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.