DPCstruct | MC43837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 104 ± 8 aa |
| Standard deviation of domain lengths | 8.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 45.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09766 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A066WE50 | 1-105 | MMGEIRRLYREACEEAVAARENVLRARLPVESTQLALQNQTYERNHLVAEVERCRAFRSIYQDAELHTVDEFFALAPPEETDPSVVY… |
| A0A183DW01 | 7-116 | ALRSRFISLRRLNRLAQYRNRKIRDQVNQERAVVEERYLQLQNIKSEIEHLQKEIERCYDFRSADEHIALVPLEEFYANAPANISQE… |
| V4B7Q0 | 109-198 | None |
| A0A7R9AWM5 | 25-135 | None |
| W2SYS6 | 1-115 | None |
| A0A0R3Q024 | 26-130 | None |
| H2XUZ2 | 67-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.