DPCstruct | MC43836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 515 ± 85 aa |
| Standard deviation of domain lengths | 85.43 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A066VG21 | 39-520 | SQISFAPLGTELNKYSAEVTQSTDRGGEQAMLMASGSSVDKLGRNLFKVHLLDLANTIDSGMASANLIRLQYNTIGISDAMTMGGQG… |
| A0A364L3Y9 | 1-369 | MSCITAALGMMPLKGASAPAVSSARLRIAEETGSNAVSVALAHRTPQEILSEDSFLNAITVLQAIGGSTNAVVHLLAIANRHPKIQG… |
| A0A837PYX5 | 1-315 | None |
| A0A1V5ZGU5 | 2-437 | None |
| A0A7S4E837 | 42-614 | None |
| A0A1P8WEJ7 | 24-563 | None |
| H0ESC2 | 9-464 | None |
| A0A0M9F6J5 | 45-581 | None |
| A0A4T0GFF6 | 332-868 | None |
| A0A2G5ZD06 | 33-686 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.