DPCstruct | MC4383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 172 ± 29 aa |
| Standard deviation of domain lengths | 28.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 21.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2IV31 | 3-172 | RQRQPSIVQCEVVPGPDELSCPRPAFGDRPRLCADHWKEYKCLTATYKALTEKAKQLYSEVFATDWENATLWTVENVNSALATAREC… |
| A0A371DGN3 | 1-145 | MGKPRCWAQVTLSDGRQKQCTKAPPAGTHYCVEHHQFYVRRTDTYKKATLEMEALDDAFVSIGDTHVEGLGQEDLAYVAEIARAYLE… |
| A0A146I0P7 | 1-137 | None |
| A0A1C7LV75 | 307-505 | None |
| A0A1C7LSA5 | 1-233 | None |
| A0A0C3PPU0 | 34-169 | None |
| A0A146I1K6 | 48-213 | None |
| A0A3N4IEI1 | 10-192 | None |
| A0A1C7LUA5 | 6-182 | None |
| A0A4Y7SFL2 | 34-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.