DPCstruct | MC43829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 145 ± 12 aa |
| Standard deviation of domain lengths | 11.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5ZQ54 | 1-143 | MTWHSLTDPPDWAAPYTRACQNIHTFPVLIGEAGGHDGMLSSPILLYDYPDIAPESPGDLHDATEIDEILSLRTLTLTEAEKREARA… |
| A0A358SIJ6 | 13-154 | GTFLSMTDPPEWAAAAVADCENIATWPVLAGPQDCHDLVLSSPVILYDHPEVAAESAGDLFDATEIDEILTLRTLALTDAEKRQARA… |
| A0A7V9SD60 | 125-291 | None |
| A0A4R9E3M3 | 52-205 | None |
| A0A7V9PTH9 | 47-190 | None |
| A0A7W1LB91 | 171-300 | None |
| A0A1I2FFS0 | 131-255 | None |
| A0A4Y8LVU0 | 77-226 | None |
| E3J6G0 | 267-423 | None |
| A0A368VVG7 | 458-596 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.