DPCstruct | MC4382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 8.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 35.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A328K478 | 47-142 | RHLIDDVIVWFHERNIAKGNGDGQVKKLLEEVYEFQEAHENSNDFEAKDGIGDIMVVLIGYCLQRGWTIEECLQQAYDEIKTRQGHV… |
| A0A811CZI5 | 2-100 | NELIKQVEQWSRDKGLDKSNSFTQFAKTNEEVGEIAAALCRNDREALRDGIGDVIVTLVILAQQNHMTLQECLEQAYGEIKDRKGKM… |
| A0A5Q2P1Y6 | 54-149 | None |
| A0A6F9XJ60 | 103-202 | None |
| A0A380F196 | 61-164 | None |
| A0A1Z9AZR7 | 152-251 | None |
| A0A2E4HLC3 | 7-123 | None |
| S5NBD4 | 65-168 | None |
| A0A382V442 | 6-102 | None |
| U7UEI1 | 61-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.