DPCstruct | MC43819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 138 ± 22 aa |
| Standard deviation of domain lengths | 21.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6CR36 | 1-116 | MLIGADPTQVNLSHDEAAFDFGDFHLKPLARFTLDARLLHSRVYRFDPGARLVPIDLAVGWGPMSDQQVLDRLRITQSMRFFWYEYQ… |
| A0A1V4X4Z1 | 21-154 | PSPSGRDGSPIDVLQPPEMESRKPEIIRLSRDGYDITITRKAGYTVRGIVVGRENYTSGWNALISPADVALCWGKIAENETYRRLKW… |
| A0A525BX78 | 10-173 | None |
| A0A7W1UA09 | 1-153 | None |
| A0A1F9MZU1 | 1-120 | None |
| A0A1J4S9M1 | 1-163 | None |
| A0A257UA93 | 302-455 | None |
| A0A1F6PE24 | 53-229 | None |
| A0A7C1UK67 | 47-204 | None |
| A0A0G1TAG2 | 10-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.